China

rt

  Manufacturers,Wholesalers,rt Exporters,factories, Suppliers,Companies and Distributors
Manufacturer Directory, Importers, Exporters, Suppliers, Wholesale
Today's News: China vogmall.com wholesaler and trader of brand shoes fashion items     India Kiran Mineral Industries     China WholesaleDeals.co.uk Scam Company     China Vipeak Heavy Industry Group Company     China Chongqing Xindeqin Enviroment-friendly and Energy-efficient Development Co., Ltd.     China shanghai SiDa trade co,.Ltd.     China IIN INTERNATIONAL TRADE CO.,LTD.     China ZeDe Plastic mould CO.,LTD     China Ginkgo industry     India SHREE BALAAD HANDLING WORKS     China YF AUTO Technology Co.,Ltd     China Li Jian Mei(Beijing) Tech.& Dev. Co., Ltd     Pakistan Sintraco Surgical     China xiandai machinery.co,Ltd     more
 Home> China Manufacturers >

rt

 Sell Offers  Buy Offers  Products  Companies

Contact Now

Ginde Plastic Pipe Industry Group
 Ginde Plastic Pipe Industry Group

9 Industrial Bases, 900 Sales Offices and 1000 Trucks with GPS of logistic distribution, GINDE serves every corner of China. With reliable quality, superior service and competitive price, GINDE has th

China China

[Related Categories : Chemicals  ]

[Main Products : rt, ppr, pap, pe, pe rt, pvc u pipe and fitting  ]

Contact Now

Weifang Palconn Plastic Technology Co., Ltd.
 Weifang Palconn Plastic Technology Co., Ltd.

Weifang Palconn Plastics Technology Co LTD is located in China's beautiful kite capital -Weifang of Shandong province,only one hour drive from Qingdao.Traffic is very convenient and scenery is very at

China China

[Related Categories : Rubber & Plastics  ]

[Main Products : rt, pipes fittings tubes plastics machinery, PEX PE RT PPR PB HEPE, PE80 PE100 UPVC, PEX AL PEX PPR AL PPR, EVOH ANTI UV GLASS FIBER PIPES, plastics pipes fittings machinery raw materia  ]

Contact Now

dae inc
 dae inc

waercqwer wqetg erg erge yre bnasbf fSH FSKFJSEFSDJCVJSCJSCBBCHDJDPWKPWEDWPFDCKEWENWWDKCWQPEQVNWQDKNCWQJCOWQJC

United_States United_States

[Related Categories : Office Supplies  ]

[Main Products : rt, rgsrdg er, r hrhther, rt yrtyret  ]

Contact Now

SHANDONG G.STAR SCIENCE AND TECHNOLOGY CO.,LTD
 SHANDONG G.STAR SCIENCE AND TECHNOLOGY CO.,LTD

SHANDONG G.STAR SCIENCE AND TECHNOLOGY CO.,LTD, Found in 2000,all kinds of plastic pipes and fittings manufacturer in China,for exaple: PPR pipe,pe pipe,pex pipe,pert pipe,pap pipe,pe-al-pe pipe,pex-a

China China

[Related Categories : Construction & Real Estate  ]

[Main Products : rt, ppr pipe, PE pipe, PEX pipe, PE RT pipe, pe al pe pipe, pex al pex pip  ]

Contact Now

Swin Industrial Co,Ltd
 Swin Industrial Co,Ltd

Foshan is the third largest city in Guangdong Province,Swin Building Industrial Co., Ltd was located in the hinterland of it ,founded in 1999, is specialized in the production of new plastic pipe, in

China China

[Related Categories : Construction & Real Estate  ]

[Main Products : rt, PP R water supply pipe, PE RT underfloor heating pipes, aluminum plastic tube water and gas pipelines, UPVC drainage, PVC threading pipe, Brass fittin  ]

Contact Now

Geneshun Biotech Ltd
 Geneshun Biotech Ltd

GeneShun Biotech Ltd is mainly engaged in developing, manufacturing and marketing of life science product and devotes to provide innovative product for life science researchers. Through advanced tech

China China

[Related Categories : Health & Beauty  ]

[Main Products : rt, Agarose, RNase A, spin column, RT PCR, Taq DNA Polymerase, DNA ladde  ]

Contact Now

Aremm Digital
 Aremm Digital

This is a new copmany that deals with generale trading, focused on technology . We are a new full of potential groop aimming to do business with good companies that supplies good services ..we are loo

Lebanon Lebanon

[Related Categories : Computer Hardware & Software  ]

[Main Products : rt, aa, ss, se, dd, r  ]

Contact Now

SHPES Pipe Industrial Co.,Ltd
 SHPES Pipe Industrial Co.,Ltd

SHPES Pipe Industrial Co.,Ltd is an integrated enterprise for R&D ,design, manufacture, marketing, and service, specializing in the production of PPR pipes, PPR stabi pipe, PPR fiber composite pipe an

China China

[Related Categories : Construction & Real Estate  ]

[Main Products : rt, plastic pipe, PP Pipe, PP R Pipe, PVC Pipe, PE Pip  ]

Ads by Google

rt Products Page 1 Of 1
<< Previous  1  Next>>
Go to Page
 Sell Offers  Buy Offers  Products  Companies
Select    contact now or add to basket
rt Offers Page 1 Of 3

Contact Now

Sell Male Thread Coupling
sell Sell Male Thread Coupling

Zhejiang Zhekang Industry Co., Ltd is a professional male coupling,stainless steel coupling,pipe coupling,ppr male thread coupling,plumbing pipe fitting,pe-rt pipe fitting,male threaded coupling,stainless steel,male coil,adaptor male,connectors for flexible cable manufacturer and exporter.

China China
   
Company: Zhejiang Zhekang Industry Co., Ltd

[Related Categories: Construction & Real Estate, Construction Material Making Machinery Parts ]

[Related Keywords:pe-rt pipe fitting,male coupling, stainless steel coupling]

Contact Now

Sell Used TADANO TR300M 30T rough terrain crane 1997Y
sell Sell Used TADANO TR300M 30T rough terrain crane 1997Y

Shanghai Chinye Construction Machinery trading Company is a professional rough terrain crane,tadano rough terrain crane,30 t rough terrain crane,tr300m rt crane manufacturer and exporter.

China China
   
Company: Shanghai Chinye Construction Machinery trading Company

[Related Categories: Construction & Real Estate, Construction Machinery ]

[Related Keywords:tr300m rt crane,rough terrain crane, tadano rough terrain crane]

Contact Now

Sell Agarose(Low EEO)
sell Sell Agarose(Low EEO)

Geneshun Biotech Ltd is a professional agarose,dna electrophoresis,dna marker,taq dna polymerase,genomic dna,argarose,dna amplification,rt-pcr,spin column,rna isolation,protein isolation,100bp dna ladder manufacturer and exporter.

China China
   
Company: Geneshun Biotech Ltd

[Related Categories: Health & Beauty, Bio-technology Products ]

[Related Keywords:rt-pcr,agarose, dna electrophoresis]

Contact Now

PE-RT pipe
sell PE-RT pipe

ZUNYI C.X.INDUSTRY & TRADE CO.,LTD. is a professional pex,pe-rt,pex pipe,pe,plastic pipe manufacturer and exporter.

China China
   
Company: ZUNYI C.X.INDUSTRY & TRADE CO.,LTD.

[Related Categories: Construction & Real Estate, Pipe & Fittings, Plastic Pipes ]

[Related Keywords:pe-rt,pex, pex pipe]

Contact Now

TXS manufacturing PE-RT floor warm pipe equipment
sell TXS manufacturing PE-RT floor warm pipe equipment

qingdao tongxinsheng plastic machinery co., ltd sales department is a professional pe-rt pipe mach,plastic sheet l,plastic profile,plastic extrude manufacturer and exporter.

China China
   
Company: qingdao tongxinsheng plastic machinery co., ltd sales department

[Related Categories: Manufacturing Machinery, Other Machinery, Other Manufacturing & Processing Machinery ]

[Related Keywords:pe-rt pipe mach,plastic sheet l, plastic profile]

Contact Now

China TXS Supply PE-RT floor warm pipe machine20091010
sell China TXS Supply PE-RT floor warm pipe machine20091010

qingdao tongxinsheng plastic machinery co., ltd sales department is a professional pe-rt pipe mach,plastic sheet l,plastic profile,plastic extrude manufacturer and exporter.

China China
   
Company: qingdao tongxinsheng plastic machinery co., ltd sales department

[Related Categories: Manufacturing Machinery, Other Machinery, Other Manufacturing & Processing Machinery ]

[Related Keywords:plastic extrude]

rt Offers Page 1 Of 3
<< Previous  1  2 3 Next>>
Go to Page
Tradevv Buyers Consultancyminimize
Our trade consultants can help you find best suppliers, who have passed our verification criterions. To get advantage of this free feature, please tell us what are you looking for.

Describe your need
How can we contact you back
Subject:
Buy Products:
Company:
Name:
Email:
Tel: - -
Fax: - -
Homepage:
Country:
Verification Code：
Tradevv Buyers...
Describe your need